PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn389751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 223aa    MW: 25835 Da    PI: 6.919
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn389751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18122162345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eE+ +l++a++q G++ W+tIar+++ gRt++ +k++w+
       Achn389751 122 LWTEEEEMILIEAHTQIGNK-WATIARKLP-GRTENTIKNHWN 162
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.01E-15118172IPR009057Homeodomain-like
SMARTSM007175.9E-14119167IPR001005SANT/Myb domain
PROSITE profilePS5129417.165120169IPR017930Myb domain
PfamPF002497.2E-15122162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-18123163IPR009057Homeodomain-like
CDDcd001674.68E-11123165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MVMATRYSPQ ILNQEDQNYH PLNYQELGSM NVSHSNEFSS LTTEDKRETK EMETKDDLKE  60
QKEAHPEESS EGHQNSILVK GQWTHDEDKT ALHNVMKCRG FPFVLHMHKP WVPFYLHFMK  120
DLWTEEEEMI LIEAHTQIGN KWATIARKLP GRTENTIKNH WNATKRRRFS KQKDKPNSIL  180
QEYIKSLSSN SVQDDATKSP LSGQICNSDE SLKISFSAKM SP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1idz_A5e-16116169154MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
1idy_A5e-16116169154MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
1msf_C9e-16771691105C-Myb DNA-Binding Domain
1mse_C9e-16771691105C-Myb DNA-Binding Domain
1a5j_A1e-15781695108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S7L28e-28MYB98_ARATH; Transcription factor MYB98
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.15e-29myb domain protein 98